Recombinant Full Length Human PRRG1 Protein
| Cat.No. : | PRRG1-407HF |
| Product Overview : | Recombinant full length Human PRRG1 with a N terminal proprietary tag; Predicted MWt 51.90 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 218 amino acids |
| Description : | This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxylation of specific glutamic acid residues by a vitamin K-dependent gamma-carboxylase. The C-terminus is proline-rich containing PPXY and PXXP motifs found in a variety of signaling and cytoskeletal proteins. This gene is highly expressed in the spinal cord. Several alternatively spliced transcript variants have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 51.900kDa inclusive of tags |
| AA Sequence : | MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREAFENNEKTKEFWSTYTKAQQGESNRGSDWFQ FYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVS TRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PRRG1 proline rich Gla (G-carboxyglutamic acid) 1 [ Homo sapiens ] |
| Official Symbol | PRRG1 |
| Synonyms | PRRG1; proline rich Gla (G-carboxyglutamic acid) 1; proline rich Gla (G carboxyglutamic acid) polypeptide 1; transmembrane gamma-carboxyglutamic acid protein 1; PRGP1 |
| Gene ID | 5638 |
| mRNA Refseq | NM_000950 |
| Protein Refseq | NP_000941 |
| MIM | 604428 |
| UniProt ID | O14668 |
| ◆ Recombinant Proteins | ||
| RFL33293HF | Recombinant Full Length Human Transmembrane Gamma-Carboxyglutamic Acid Protein 1(Prrg1) Protein, His-Tagged | +Inquiry |
| PRRG1-30706TH | Recombinant Human PRRG1 | +Inquiry |
| RFL15217BF | Recombinant Full Length Bovine Transmembrane Gamma-Carboxyglutamic Acid Protein 1(Prrg1) Protein, His-Tagged | +Inquiry |
| PRRG1-5104C | Recombinant Chicken PRRG1 | +Inquiry |
| PRRG1-3451R | Recombinant Rhesus Macaque PRRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRRG1-2811HCL | Recombinant Human PRRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRRG1 Products
Required fields are marked with *
My Review for All PRRG1 Products
Required fields are marked with *




