Recombinant Full Length Human PRRG1 Protein

Cat.No. : PRRG1-407HF
Product Overview : Recombinant full length Human PRRG1 with a N terminal proprietary tag; Predicted MWt 51.90 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 218 amino acids
Description : This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxylation of specific glutamic acid residues by a vitamin K-dependent gamma-carboxylase. The C-terminus is proline-rich containing PPXY and PXXP motifs found in a variety of signaling and cytoskeletal proteins. This gene is highly expressed in the spinal cord. Several alternatively spliced transcript variants have been found for this gene.
Form : Liquid
Molecular Mass : 51.900kDa inclusive of tags
AA Sequence : MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREAFENNEKTKEFWSTYTKAQQGESNRGSDWFQ FYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVS TRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PRRG1 proline rich Gla (G-carboxyglutamic acid) 1 [ Homo sapiens ]
Official Symbol PRRG1
Synonyms PRRG1; proline rich Gla (G-carboxyglutamic acid) 1; proline rich Gla (G carboxyglutamic acid) polypeptide 1; transmembrane gamma-carboxyglutamic acid protein 1; PRGP1
Gene ID 5638
mRNA Refseq NM_000950
Protein Refseq NP_000941
MIM 604428
UniProt ID O14668

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRRG1 Products

Required fields are marked with *

My Review for All PRRG1 Products

Required fields are marked with *

0
cart-icon