| Species : |
Human |
| Source : |
In Vitro Cell Free System |
| Protein Length : |
218 amino acids |
| Description : |
This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxylation of specific glutamic acid residues by a vitamin K-dependent gamma-carboxylase. The C-terminus is proline-rich containing PPXY and PXXP motifs found in a variety of signaling and cytoskeletal proteins. This gene is highly expressed in the spinal cord. Several alternatively spliced transcript variants have been found for this gene. |
| Form : |
Liquid |
| Molecular Mass : |
51.900kDa inclusive of tags |
| AA Sequence : |
MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREAFENNEKTKEFWSTYTKAQQGESNRGSDWFQ FYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVS TRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK |
| Purity : |
Proprietary Purification |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
