Recombinant Full Length Human PRSS8 Protein
Cat.No. : | PRSS8-404HF |
Product Overview : | Recombinant full length Human PRSS8 with N-terminal proprietary tag. Predicted MW 63.47kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 343 amino acids |
Description : | This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine. |
Form : | Liquid |
Molecular Mass : | 63.470kDa inclusive of tags |
AA Sequence : | MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVA PQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWV LSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDI IPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANA SFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRET CNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGG PLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW IQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGL LRPILFLPLGLALGLLSPWLSEH |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PRSS8 protease, serine, 8 [ Homo sapiens ] |
Official Symbol | PRSS8 |
Synonyms | PRSS8; protease, serine, 8; prostasin |
Gene ID | 5652 |
mRNA Refseq | NM_002773 |
Protein Refseq | NP_002764 |
MIM | 600823 |
UniProt ID | Q16651 |
◆ Recombinant Proteins | ||
PRSS8-1994H | Recombinant Human PRSS8 protein, His-tagged | +Inquiry |
PRSS8-3459R | Recombinant Rhesus Macaque PRSS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRSS8-30708TH | Recombinant Human PRSS8 | +Inquiry |
PRSS8-4752R | Recombinant Rat PRSS8 Protein | +Inquiry |
RFL30585HF | Recombinant Full Length Human Prostasin(Prss8) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS8-441MCL | Recombinant Mouse PRSS8 cell lysate | +Inquiry |
PRSS8-2865HCL | Recombinant Human PRSS8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS8 Products
Required fields are marked with *
My Review for All PRSS8 Products
Required fields are marked with *