Recombinant Full Length Human PRTN3 Protein, C-Flag-tagged
Cat.No. : | PRTN3-1556HFL |
Product Overview : | Recombinant Full Length Human PRTN3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; membrane protein ectodomain proteolysis; and neutrophil extravasation. Located in azurophil granule lumen; cytosol; and plasma membrane raft. Colocalizes with plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAA HCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPANLSASVATVQLP QQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICD GIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | PRTN3 proteinase 3 [ Homo sapiens (human) ] |
Official Symbol | PRTN3 |
Synonyms | MBN; MBT; NP4; P29; PR3; ACPA; AGP7; NP-4; PR-3; CANCA; C-ANCA |
Gene ID | 5657 |
mRNA Refseq | NM_002777.4 |
Protein Refseq | NP_002768.3 |
MIM | 177020 |
UniProt ID | P24158 |
◆ Recombinant Proteins | ||
PRTN3-7193M | Recombinant Mouse PRTN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRTN3-001H | Recombinant Human PRTN3 Protein, His tagged | +Inquiry |
PRTN3-3376H | Recombinant Human PRTN3 protein, His&Myc-tagged | +Inquiry |
PRTN3-301563H | Recombinant Human PRTN3 protein, GST-tagged | +Inquiry |
PRTN3-6020H | Recombinant Human PRTN3 Protein (Ile28-Arg249), N-GST tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTN3 Products
Required fields are marked with *
My Review for All PRTN3 Products
Required fields are marked with *