Recombinant Full Length Human PSMD14 protein, MBP & His-tagged

Cat.No. : PSMD14-2253H
Product Overview : Recombinant Human PSMD14 protein(O00487)(1-310aa), fused to N-terminal MBP tag and C-terminal His tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&MBP
Protein Length : 1-310aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 79.2 kDa
AA Sequence : MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name PSMD14 proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 [ Homo sapiens ]
Official Symbol PSMD14
Synonyms PSMD14; proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; 26S proteasome non-ATPase regulatory subunit 14; pad1; POH1; Rpn11; 26S proteasome regulatory subunit rpn11; 26S proteasome-associated PAD1 homolog 1; PAD1; RPN11;
Gene ID 10213
mRNA Refseq NM_005805
Protein Refseq NP_005796
MIM 607173
UniProt ID O00487

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMD14 Products

Required fields are marked with *

My Review for All PSMD14 Products

Required fields are marked with *

0
cart-icon
0
compare icon