Recombinant Full Length Human PSTK protein, His-tagged
| Cat.No. : | PSTK-2039H |
| Product Overview : | Recombinant Human PSTK protein(1-348 aa), fused with His tag, was expressed in E.coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-348 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MKTAENIRGTGSDGPRKRGLCVLCGLPAAGKSTFARALAHRLQQEQGWAIGVVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLEYFLMAVINGCQMSVPPNRTEAMWEDFITCLKDQDLIFSAAFEAQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQRPQALPPETIHLMRRKLEKPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAEDNMEQKDTDRIICSTNILHKTDQTLRRIVSQTMKEAKGNQEAFSEMTFKQRWVRANHAAIWRIILGNEHIKCRSAKVGWLQCCRIEKRPLSTG |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PSTK phosphoseryl-tRNA kinase [ Homo sapiens ] |
| Official Symbol | PSTK |
| Synonyms | PSTK; phosphoseryl-tRNA kinase; C10orf89, chromosome 10 open reading frame 89; L-seryl-tRNA(Sec) kinase; MGC35392; O-phosphoseryl-tRNA(Sec) kinase; C10orf89; |
| Gene ID | 118672 |
| mRNA Refseq | NM_153336 |
| Protein Refseq | NP_699167 |
| MIM | 611310 |
| UniProt ID | Q8IV42 |
| ◆ Recombinant Proteins | ||
| PSTK-13615M | Recombinant Mouse PSTK Protein | +Inquiry |
| PSTK-7236M | Recombinant Mouse PSTK Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSTK-2039H | Recombinant Full Length Human PSTK protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSTK-514HCL | Recombinant Human PSTK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSTK Products
Required fields are marked with *
My Review for All PSTK Products
Required fields are marked with *
