Recombinant Full Length Human PTGES3 protein, GST-tagged
Cat.No. : | PTGES3-301648H |
Product Overview : | Recombinant Human PTGES3 (1-160 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Glu160 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PTGES3 prostaglandin E synthase 3 [ Homo sapiens (human) ] |
Official Symbol | PTGES3 |
Synonyms | P23; TEBP; cPGES |
Gene ID | 10728 |
mRNA Refseq | NM_001282601 |
Protein Refseq | NP_001269530 |
MIM | 607061 |
UniProt ID | Q15185 |
◆ Recombinant Proteins | ||
PTGES3-3692R | Recombinant Rhesus monkey PTGES3 Protein, His-tagged | +Inquiry |
PTGES3-13642M | Recombinant Mouse PTGES3 Protein | +Inquiry |
PTGES3-4704C | Recombinant Chicken PTGES3 | +Inquiry |
PTGES3-3510R | Recombinant Rhesus Macaque PTGES3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGES3-7254M | Recombinant Mouse PTGES3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGES3-2712HCL | Recombinant Human PTGES3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGES3 Products
Required fields are marked with *
My Review for All PTGES3 Products
Required fields are marked with *
0
Inquiry Basket