Recombinant Human PTGES3 protein, His-tagged

• Cat.No.: PTGES3-4508H
• Product Overview: Recombinant Human PTGES3 protein(Q15185)(1-160aa), fused to N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-160aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.7 kDa
• AA Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PTGES3 prostaglandin E synthase 3 (cytosolic) [ Homo sapiens ]
• Official Symbol: PTGES3
• Synonyms: PTGES3; prostaglandin E synthase 3 (cytosolic); prostaglandin E synthase 3; cPGES; p23; TEBP; Hsp90 co-chaperone; telomerase-binding protein p23; progesterone receptor complex p23; cytosolic prostaglandin E synthase; cytosolic prostaglandin E2 synthase; unactive progesterone receptor, 23 kD; P23
• Gene ID: 10728
• mRNA Refseq: NM_006601
• Protein Refseq: NP_006592
• MIM: 607061
• UniProt ID: Q15185