Recombinant Human PTGES3 protein, His-tagged

Cat.No. : PTGES3-4508H
Product Overview : Recombinant Human PTGES3 protein(Q15185)(1-160aa), fused to N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-160aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.7 kDa
AA Sequence : MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name PTGES3 prostaglandin E synthase 3 (cytosolic) [ Homo sapiens ]
Official Symbol PTGES3
Synonyms PTGES3; prostaglandin E synthase 3 (cytosolic); prostaglandin E synthase 3; cPGES; p23; TEBP; Hsp90 co-chaperone; telomerase-binding protein p23; progesterone receptor complex p23; cytosolic prostaglandin E synthase; cytosolic prostaglandin E2 synthase; unactive progesterone receptor, 23 kD; P23;
Gene ID 10728
mRNA Refseq NM_006601
Protein Refseq NP_006592
MIM 607061
UniProt ID Q15185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGES3 Products

Required fields are marked with *

My Review for All PTGES3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon