Recombinant Full Length Human PYCR2 Protein, C-Flag-tagged
Cat.No. : | PYCR2-2161HFL |
Product Overview : | Recombinant Full Length Human PYCR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the pyrroline-5-carboxylate reductase family. The encoded mitochondrial protein catalyzes the conversion of pyrroline-5-carboxylate to proline, which is the last step in proline biosynthesis. Alternatively spliced transcript variants have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Arginine and proline metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | PYCR2 pyrroline-5-carboxylate reductase 2 [ Homo sapiens (human) ] |
Official Symbol | PYCR2 |
Synonyms | HLD10; P5CR2 |
Gene ID | 29920 |
mRNA Refseq | NM_013328.4 |
Protein Refseq | NP_037460.2 |
MIM | 616406 |
UniProt ID | Q96C36 |
◆ Recombinant Proteins | ||
Pycr2-5271M | Recombinant Mouse Pycr2 Protein, Myc/DDK-tagged | +Inquiry |
PYCR2-46H | Recombinant Human PYCR2, His-tagged | +Inquiry |
PYCR2-1816H | Recombinant Human PYCR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PYCR2-2085H | Recombinant Human PYCR2, GST-tagged | +Inquiry |
CRY20 | Recombinant Human Pyrroline-5-carboxylate Reductase 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYCR2-2647HCL | Recombinant Human PYCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYCR2 Products
Required fields are marked with *
My Review for All PYCR2 Products
Required fields are marked with *
0
Inquiry Basket