Recombinant Full Length Human RAB3C Protein, C-Flag-tagged

Cat.No. : RAB3C-932HFL
Product Overview : Recombinant Full Length Human RAB3C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 25.8 kDa
AA Sequence : MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ
NTRLKETPPPPQPNCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Full Length : Full L.
Gene Name RAB3C RAB3C, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB3C
Synonyms 2700062I01Rik; 3110015B08Rik; 3110037E15Rik; AI850886; MGC124069; RAB3C, member RAS oncogene family; small GTP-binding protein Rab3C
Gene ID 115827
mRNA Refseq NM_138453.4
Protein Refseq NP_612462.1
MIM 612829
UniProt ID Q96E17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB3C Products

Required fields are marked with *

My Review for All RAB3C Products

Required fields are marked with *

0
cart-icon
0
compare icon