Recombinant Full Length Human RAB3C Protein, C-Flag-tagged
Cat.No. : | RAB3C-932HFL |
Product Overview : | Recombinant Full Length Human RAB3C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ NTRLKETPPPPQPNCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RAB3C RAB3C, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB3C |
Synonyms | 2700062I01Rik; 3110015B08Rik; 3110037E15Rik; AI850886; MGC124069; RAB3C, member RAS oncogene family; small GTP-binding protein Rab3C |
Gene ID | 115827 |
mRNA Refseq | NM_138453.4 |
Protein Refseq | NP_612462.1 |
MIM | 612829 |
UniProt ID | Q96E17 |
◆ Recombinant Proteins | ||
Rab3c-5318M | Recombinant Mouse Rab3c Protein, Myc/DDK-tagged | +Inquiry |
RAB3C-2120H | Recombinant Human RAB3C, GST-tagged | +Inquiry |
RAB3C-2301H | Recombinant Human RAB3C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB3C-4550R | Recombinant Rat RAB3C Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB3C-654Z | Recombinant Zebrafish RAB3C | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB3C-2598HCL | Recombinant Human RAB3C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB3C Products
Required fields are marked with *
My Review for All RAB3C Products
Required fields are marked with *