Recombinant Full Length Human RAB3C Protein, C-Flag-tagged

• Cat.No.: RAB3C-932HFL
• Product Overview: Recombinant Full Length Human RAB3C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 25.8 kDa
• AA Sequence: MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ
  NTRLKETPPPPQPNCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: RAB3C RAB3C, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB3C
• Synonyms: 2700062I01Rik; 3110015B08Rik; 3110037E15Rik; AI850886; MGC124069; RAB3C, member RAS oncogene family; small GTP-binding protein Rab3C
• Gene ID: 115827
• mRNA Refseq: NM_138453.4
• Protein Refseq: NP_612462.1
• MIM: 612829
• UniProt ID: Q96E17