Recombinant Full Length Human RAB8A Protein

Cat.No. : RAB8A-419HF
Product Overview : Recombinant full length Human RAB8A with N terminal proprietary tag; predicted MWt 48.77 kDa inclusive of tag; P61006, AAH02977.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 207 amino acids
Description : The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
Form : Liquid
Molecular Mass : 48.770kDa inclusive of tags
AA Sequence : MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFIST IGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRG AMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVEN AFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS FFRCVLL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name RAB8A RAB8A, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB8A
Synonyms RAB8A; RAB8A, member RAS oncogene family; MEL, mel transforming oncogene (derived from cell line NK14); ras-related protein Rab-8A; RAB8
Gene ID 4218
mRNA Refseq NM_005370
Protein Refseq NP_005361
MIM 165040
UniProt ID P61006

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB8A Products

Required fields are marked with *

My Review for All RAB8A Products

Required fields are marked with *

0
cart-icon