Recombinant Full Length Human RAC1 Protein, C-Flag-tagged
Cat.No. : | RAC1-1105HFL |
Product Overview : | Recombinant Full Length Human RAC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.3 kDa |
AA Sequence : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYP QGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Adherens junction, Amyotrophic lateral sclerosis (ALS), Axon guidance, B cell receptor signaling pathway, Chemokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, Toll-like receptor signaling pathway, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | RAC1 Rac family small GTPase 1 [ Homo sapiens (human) ] |
Official Symbol | RAC1 |
Synonyms | MIG5; MRD48; Rac-1; TC-25; p21-Rac1 |
Gene ID | 5879 |
mRNA Refseq | NM_006908.5 |
Protein Refseq | NP_008839.2 |
MIM | 602048 |
UniProt ID | P63000 |
◆ Recombinant Proteins | ||
RAC1-4567R | Recombinant Rat RAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAC1-193H | Recombinant Human RAC1(Y72C) protein, His-tagged | +Inquiry |
RAC1-2147H | Recombinant Human RAC1, His-tagged | +Inquiry |
RAC1-13857M | Recombinant Mouse RAC1 Protein | +Inquiry |
RAC1-190H | Active Recombinant Human RAC1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAC1-712HCL | Recombinant Human RAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAC1 Products
Required fields are marked with *
My Review for All RAC1 Products
Required fields are marked with *
0
Inquiry Basket