Recombinant Full Length Human RAC3 protein, GST-tagged
Cat.No. : | RAC3-3406H |
Product Overview : | Recombinant Human RAC3 protein(P60763)(1-192aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-192 a.a. |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48 kDa |
AA Sequence : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RAC3 ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) [ Homo sapiens ] |
Official Symbol | RAC3 |
Synonyms | RAC3; ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3); ras-related C3 botulinum toxin substrate 3; p21-Rac3; rho family, small GTP binding protein Rac3; |
Gene ID | 5881 |
mRNA Refseq | NM_005052 |
Protein Refseq | NP_005043 |
MIM | 602050 |
UniProt ID | P60763 |
◆ Recombinant Proteins | ||
RAC3-31284TH | Recombinant Human RAC3 | +Inquiry |
RAC3-3936H | Recombinant Human RAC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAC3-7381M | Recombinant Mouse RAC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAC3-3406H | Recombinant Full Length Human RAC3 protein, GST-tagged | +Inquiry |
RAC3-6325H | Recombinant Human RAC3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAC3-2566HCL | Recombinant Human RAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAC3 Products
Required fields are marked with *
My Review for All RAC3 Products
Required fields are marked with *
0
Inquiry Basket