Recombinant Full Length Human RAD54L Protein, C-Flag-tagged
Cat.No. : | RAD54L-1549HFL |
Product Overview : | Recombinant Full Length Human RAD54L Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 84.2 kDa |
AA Sequence : | MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQH EAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLP VHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPE IDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRL HVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTA HEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKAL EPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEK IFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCT SDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Homologous recombination |
Full Length : | Full L. |
Gene Name | RAD54L RAD54 like [ Homo sapiens (human) ] |
Official Symbol | RAD54L |
Synonyms | HR54; hHR54; RAD54A; hRAD54 |
Gene ID | 8438 |
mRNA Refseq | NM_003579.4 |
Protein Refseq | NP_003570.2 |
MIM | 603615 |
UniProt ID | Q92698 |
◆ Recombinant Proteins | ||
RAD54L-390H | Recombinant Human RAD54L Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAD54L-5042H | Recombinant Human RAD54L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAD54L-11363Z | Recombinant Zebrafish RAD54L | +Inquiry |
RAD54L-1853H | Recombinant Human RAD54L Protein, His (Fc)-Avi-tagged | +Inquiry |
RAD54L-1549HFL | Recombinant Full Length Human RAD54L Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD54L-2552HCL | Recombinant Human RAD54L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD54L Products
Required fields are marked with *
My Review for All RAD54L Products
Required fields are marked with *
0
Inquiry Basket