Recombinant Full Length Human RALBP1 Protein, C-Flag-tagged
Cat.No. : | RALBP1-340HFL |
Product Overview : | Recombinant Full Length Human RALBP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RAL. Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive to the active state through the action of RALGDS, which in turn is activated by RAS. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 75.9 kDa |
AA Sequence : | MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGK KKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEK HKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLP AVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLT KELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTV QISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEIL TEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSSESESESEDEEELQIILEDLQ RQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAKAEQQAQEDEEPEWRGGAVQPPRDGVLEPKA AKEQPKAGKEPAKPSPSRDRKETSITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Pancreatic cancer, Pathways in cancer |
Full Length : | Full L. |
Gene Name | RALBP1 ralA binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | RALBP1 |
Synonyms | RIP1; RLIP1; RLIP76 |
Gene ID | 10928 |
mRNA Refseq | NM_006788.4 |
Protein Refseq | NP_006779.1 |
MIM | 605801 |
UniProt ID | Q15311 |
◆ Recombinant Proteins | ||
RALBP1-4917R | Recombinant Rat RALBP1 Protein | +Inquiry |
RALBP1-3216C | Recombinant Chicken RALBP1 | +Inquiry |
RALBP1-2167H | Recombinant Human RALBP1, GST-tagged | +Inquiry |
RALBP1-340HFL | Recombinant Full Length Human RALBP1 Protein, C-Flag-tagged | +Inquiry |
Ralbp1-708M | Recombinant Mouse Ralbp1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RALBP1-2542HCL | Recombinant Human RALBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RALBP1 Products
Required fields are marked with *
My Review for All RALBP1 Products
Required fields are marked with *
0
Inquiry Basket