Recombinant Full Length Human RALY Protein, C-Flag-tagged
Cat.No. : | RALY-978HFL |
Product Overview : | Recombinant Full Length Human RALY Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.3 kDa |
AA Sequence : | MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ IAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDG DEEGLLTHSEEELEHSQDTDADDGALQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RALY RALY heterogeneous nuclear ribonucleoprotein [ Homo sapiens (human) ] |
Official Symbol | RALY |
Synonyms | P542; HNRPCL2 |
Gene ID | 22913 |
mRNA Refseq | NM_016732.3 |
Protein Refseq | NP_057951.1 |
MIM | 614663 |
UniProt ID | Q9UKM9 |
◆ Recombinant Proteins | ||
Raly-5361M | Recombinant Mouse Raly Protein, Myc/DDK-tagged | +Inquiry |
RALY-978HFL | Recombinant Full Length Human RALY Protein, C-Flag-tagged | +Inquiry |
RALY-11647Z | Recombinant Zebrafish RALY | +Inquiry |
RALY-1856H | Recombinant Human RALY Protein, His (Fc)-Avi-tagged | +Inquiry |
RALY-2169H | Recombinant Human RALY, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RALY-2539HCL | Recombinant Human RALY 293 Cell Lysate | +Inquiry |
RALY-2540HCL | Recombinant Human RALY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RALY Products
Required fields are marked with *
My Review for All RALY Products
Required fields are marked with *
0
Inquiry Basket