Recombinant Full Length Human RASGRP2 Protein, C-Flag-tagged
Cat.No. : | RASGRP2-662HFL |
Product Overview : | Recombinant Full Length Human RASGRP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Four alternatively spliced transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.1 kDa |
AA Sequence : | MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Chemokine signaling pathway, MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | RASGRP2 RAS guanyl releasing protein 2 [ Homo sapiens (human) ] |
Official Symbol | RASGRP2 |
Synonyms | CDC25L; CALDAG-GEFI |
Gene ID | 10235 |
mRNA Refseq | NM_001098671.2 |
Protein Refseq | NP_001092141.1 |
MIM | 605577 |
UniProt ID | Q7LDG7 |
◆ Recombinant Proteins | ||
RASGRP2-32H | Recombinant Human RASGRP2 protein, MYC/DDK-tagged | +Inquiry |
RASGRP2-31042TH | Recombinant Human RASGRP2, His-tagged | +Inquiry |
RASGRP2-7438M | Recombinant Mouse RASGRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RASGRP2-3793R | Recombinant Rhesus monkey RASGRP2 Protein, His-tagged | +Inquiry |
RASGRP2-33H | Recombinant Human RASGRP2 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASGRP2-2505HCL | Recombinant Human RASGRP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RASGRP2 Products
Required fields are marked with *
My Review for All RASGRP2 Products
Required fields are marked with *
0
Inquiry Basket