Recombinant Full Length Human RBX1 Protein, C-Flag-tagged

Cat.No. : RBX1-1980HFL
Product Overview : Recombinant Full Length Human RBX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 12.1 kDa
AA Sequence : MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Cell cycle, Nucleotide excision repair, Oocyte meiosis, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathwa
Full Length : Full L.
Gene Name RBX1 ring-box 1 [ Homo sapiens (human) ]
Official Symbol RBX1
Synonyms ROC1; RNF75; BA554C12.1
Gene ID 9978
mRNA Refseq NM_014248.4
Protein Refseq NP_055063.1
MIM 603814
UniProt ID P62877

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBX1 Products

Required fields are marked with *

My Review for All RBX1 Products

Required fields are marked with *

0
cart-icon