Recombinant Human RBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RBX1-969H
Product Overview : RBX1 MS Standard C13 and N15-labeled recombinant protein (NP_055063) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
Molecular Mass : 12.3 kDa
AA Sequence : MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RBX1 ring-box 1 [ Homo sapiens (human) ]
Official Symbol RBX1
Synonyms RBX1; ring-box 1, E3 ubiquitin protein ligase; ring box 1; E3 ubiquitin-protein ligase RBX1; BA554C12.1; regulator of cullins 1; RNF75; ROC1; ZYP protein; RING box protein 1; RING-box protein 1; RING finger protein 75; MGC1481; FLJ60363; MGC13357;
Gene ID 9978
mRNA Refseq NM_014248
Protein Refseq NP_055063
MIM 603814
UniProt ID P62877

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBX1 Products

Required fields are marked with *

My Review for All RBX1 Products

Required fields are marked with *

0
cart-icon