Recombinant Human RBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RBX1-969H |
| Product Overview : | RBX1 MS Standard C13 and N15-labeled recombinant protein (NP_055063) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5. |
| Molecular Mass : | 12.3 kDa |
| AA Sequence : | MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RBX1 ring-box 1 [ Homo sapiens (human) ] |
| Official Symbol | RBX1 |
| Synonyms | RBX1; ring-box 1, E3 ubiquitin protein ligase; ring box 1; E3 ubiquitin-protein ligase RBX1; BA554C12.1; regulator of cullins 1; RNF75; ROC1; ZYP protein; RING box protein 1; RING-box protein 1; RING finger protein 75; MGC1481; FLJ60363; MGC13357; |
| Gene ID | 9978 |
| mRNA Refseq | NM_014248 |
| Protein Refseq | NP_055063 |
| MIM | 603814 |
| UniProt ID | P62877 |
| ◆ Recombinant Proteins | ||
| RBX1-2389H | Recombinant Human Ring-box 1, His-tagged | +Inquiry |
| RBX1-4253C | Recombinant Chicken RBX1 | +Inquiry |
| RBX1-3416H | Recombinant Full Length Human RBX1 protein, GST-tagged | +Inquiry |
| RBX1-1980HFL | Recombinant Full Length Human RBX1 Protein, C-Flag-tagged | +Inquiry |
| RBX1-2902H | Recombinant Full Length Human RBX1, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBX1-2450HCL | Recombinant Human RBX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBX1 Products
Required fields are marked with *
My Review for All RBX1 Products
Required fields are marked with *
