Recombinant Full Length Human RBX1 protein, GST-tagged
Cat.No. : | RBX1-3416H |
Product Overview : | Recombinant Human RBX1 protein(P62877)(1-108aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-108aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RBX1 ring-box 1, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | RBX1 |
Synonyms | RBX1; ring-box 1, E3 ubiquitin protein ligase; ring box 1; E3 ubiquitin-protein ligase RBX1; BA554C12.1; regulator of cullins 1; RNF75; ROC1; ZYP protein; RING box protein 1; RING-box protein 1; RING finger protein 75; MGC1481; FLJ60363; MGC13357; |
Gene ID | 9978 |
mRNA Refseq | NM_014248 |
Protein Refseq | NP_055063 |
MIM | 603814 |
UniProt ID | P62877 |
◆ Recombinant Proteins | ||
RBX1-3416H | Recombinant Full Length Human RBX1 protein, GST-tagged | +Inquiry |
RBX1-593C | Recombinant Cynomolgus Monkey RBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBX1-4253C | Recombinant Chicken RBX1 | +Inquiry |
RBX1-1867H | Recombinant Human RBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBX1-850C | Recombinant Cynomolgus RBX1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBX1-2450HCL | Recombinant Human RBX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBX1 Products
Required fields are marked with *
My Review for All RBX1 Products
Required fields are marked with *
0
Inquiry Basket