Recombinant Full Length Human RCAN2 Protein, GST-tagged

Cat.No. : RCAN2-4710HF
Product Overview : Human DSCR1L1 full-length ORF ( AAH38509.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 225 amino acids
Description : This gene encodes a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
Molecular Mass : 51.5 kDa
AA Sequence : MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RCAN2 regulator of calcineurin 2 [ Homo sapiens ]
Official Symbol RCAN2
Synonyms RCAN2; regulator of calcineurin 2; Down syndrome critical region gene 1 like 1 , DSCR1L1; calcipressin-2; ZAKI 4; Down syndrome candidate region 1-like 1; thyroid hormone-responsive protein ZAKI-4; Down syndrome critical region gene 1-like 1; thyroid hormone-responsive (skin fibroblasts); myocyte-enriched calcineurin-interacting protein 2; CSP2; RCN2; MCIP2; ZAKI4; ZAKI-4; DSCR1L1;
Gene ID 10231
mRNA Refseq NM_001251973
Protein Refseq NP_001238902
MIM 604876
UniProt ID Q14206

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCAN2 Products

Required fields are marked with *

My Review for All RCAN2 Products

Required fields are marked with *

0
cart-icon