Recombinant Full Length Human RCAN2 Protein, GST-tagged
| Cat.No. : | RCAN2-4710HF |
| Product Overview : | Human DSCR1L1 full-length ORF ( AAH38509.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 225 amino acids |
| Description : | This gene encodes a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011] |
| Molecular Mass : | 51.5 kDa |
| AA Sequence : | MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RCAN2 regulator of calcineurin 2 [ Homo sapiens ] |
| Official Symbol | RCAN2 |
| Synonyms | RCAN2; regulator of calcineurin 2; Down syndrome critical region gene 1 like 1 , DSCR1L1; calcipressin-2; ZAKI 4; Down syndrome candidate region 1-like 1; thyroid hormone-responsive protein ZAKI-4; Down syndrome critical region gene 1-like 1; thyroid hormone-responsive (skin fibroblasts); myocyte-enriched calcineurin-interacting protein 2; CSP2; RCN2; MCIP2; ZAKI4; ZAKI-4; DSCR1L1; |
| Gene ID | 10231 |
| mRNA Refseq | NM_001251973 |
| Protein Refseq | NP_001238902 |
| MIM | 604876 |
| UniProt ID | Q14206 |
| ◆ Recombinant Proteins | ||
| RCAN2-4632R | Recombinant Rat RCAN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RCAN2-713H | Recombinant Human RCAN2 Protein, GST/His-tagged | +Inquiry |
| RCAN2-4750H | Recombinant Human Regulator Of Calcineurin 2, His-tagged | +Inquiry |
| RCAN2-28376TH | Recombinant Human RCAN2, His-tagged | +Inquiry |
| RCAN2-4031H | Recombinant Human RCAN2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RCAN2-2449HCL | Recombinant Human RCAN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCAN2 Products
Required fields are marked with *
My Review for All RCAN2 Products
Required fields are marked with *



