Recombinant Human RCAN2 Protein, GST-tagged
Cat.No. : | RCAN2-4031H |
Product Overview : | Human DSCR1L1 full-length ORF ( AAH38509.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RCAN2 regulator of calcineurin 2 [ Homo sapiens ] |
Official Symbol | RCAN2 |
Synonyms | RCAN2; regulator of calcineurin 2; Down syndrome critical region gene 1 like 1 , DSCR1L1; calcipressin-2; ZAKI 4; Down syndrome candidate region 1-like 1; thyroid hormone-responsive protein ZAKI-4; Down syndrome critical region gene 1-like 1; thyroid hormone-responsive (skin fibroblasts); myocyte-enriched calcineurin-interacting protein 2; CSP2; RCN2; MCIP2; ZAKI4; ZAKI-4; DSCR1L1; |
Gene ID | 10231 |
mRNA Refseq | NM_001251973 |
Protein Refseq | NP_001238902 |
MIM | 604876 |
UniProt ID | Q14206 |
◆ Recombinant Proteins | ||
RCAN2-4750H | Recombinant Human Regulator Of Calcineurin 2, His-tagged | +Inquiry |
RCAN2-4710HF | Recombinant Full Length Human RCAN2 Protein, GST-tagged | +Inquiry |
RCAN2-4031H | Recombinant Human RCAN2 Protein, GST-tagged | +Inquiry |
RCAN2-4973R | Recombinant Rat RCAN2 Protein | +Inquiry |
RCAN2-12828Z | Recombinant Zebrafish RCAN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCAN2-2449HCL | Recombinant Human RCAN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RCAN2 Products
Required fields are marked with *
My Review for All RCAN2 Products
Required fields are marked with *
0
Inquiry Basket