Recombinant Human RCC1 protein, GST-tagged
| Cat.No. : | RCC1-2229H |
| Product Overview : | Recombinant Human RCC1 protein(1-421 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-421 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RCC1 regulator of chromosome condensation 1 [ Homo sapiens ] |
| Official Symbol | RCC1 |
| Synonyms | RCC1; regulator of chromosome condensation 1; CHC1, chromosome condensation 1; regulator of chromosome condensation; cell cycle regulatory protein; SNHG3-RCC1 readthrough transcript; guanine nucleotide-releasing protein; CHC1; RCC1-I; SNHG3-RCC1; |
| mRNA Refseq | NM_001048194 |
| Protein Refseq | NP_001041659 |
| MIM | 179710 |
| UniProt ID | P18754 |
| Gene ID | 1104 |
| ◆ Recombinant Proteins | ||
| RCC1-1868H | Recombinant Human RCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RCC1-12391Z | Recombinant Zebrafish RCC1 | +Inquiry |
| RCC1-181H | Recombinant Human RCC1 Protein, Strep-tagged | +Inquiry |
| RCC1-1340H | Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RCC1-738HFL | Recombinant Full Length Human RCC1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCC1 Products
Required fields are marked with *
My Review for All RCC1 Products
Required fields are marked with *
