Recombinant Full Length Human RCC1 protein, His-tagged
| Cat.No. : | RCC1-01H |
| Product Overview : | Recombinant Human RCC1 protein(NP_001041659.1), fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-421 a.a. |
| Form : | 50 mM Tris-HCl (pH 8.0), 300 mM NaCl |
| Molecular Mass : | The protein has a calculated MW of 46 kDa. |
| AA Sequence : | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSLEHHHHHH |
| Purity : | > 95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.8 mg/ml |
| Gene Name | RCC1 regulator of chromosome condensation 1 [ Homo sapiens (human) ] |
| Official Symbol | RCC1 |
| Synonyms | CHC1; RCC1-I; SNHG3-RCC1 |
| Gene ID | 1104 |
| mRNA Refseq | NM_001048194.4 |
| Protein Refseq | NP_001041659.1 |
| MIM | 179710 |
| UniProt ID | P18754 |
| ◆ Recombinant Proteins | ||
| RCC1-2230H | Recombinant Human RCC1 protein, His-tagged | +Inquiry |
| RCC1-2229H | Recombinant Human RCC1 protein, GST-tagged | +Inquiry |
| RCC1-1340H | Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RCC1-1139H | Recombinant Human Regulator Of Chromosome Condensation 1 | +Inquiry |
| RCC1-1868H | Recombinant Human RCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCC1 Products
Required fields are marked with *
My Review for All RCC1 Products
Required fields are marked with *
