Recombinant Full Length Human RCC1 protein, His-tagged
Cat.No. : | RCC1-01H |
Product Overview : | Recombinant Human RCC1 protein(NP_001041659.1), fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-421 a.a. |
Form : | 50 mM Tris-HCl (pH 8.0), 300 mM NaCl |
Molecular Mass : | The protein has a calculated MW of 46 kDa. |
AA Sequence : | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSLEHHHHHH |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.8 mg/ml |
Gene Name | RCC1 regulator of chromosome condensation 1 [ Homo sapiens (human) ] |
Official Symbol | RCC1 |
Synonyms | CHC1; RCC1-I; SNHG3-RCC1 |
Gene ID | 1104 |
mRNA Refseq | NM_001048194.4 |
Protein Refseq | NP_001041659.1 |
MIM | 179710 |
UniProt ID | P18754 |
◆ Recombinant Proteins | ||
RCC1-181H | Recombinant Human RCC1 Protein, Strep-tagged | +Inquiry |
Rcc1-019M | Recombinant Full Length Mouse Rcc1 Protein, MYC/DDK-tagged | +Inquiry |
RCC1-2230H | Recombinant Human RCC1 protein, His-tagged | +Inquiry |
RCC1-2229H | Recombinant Human RCC1 protein, GST-tagged | +Inquiry |
RCC1-2204H | Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCC1 Products
Required fields are marked with *
My Review for All RCC1 Products
Required fields are marked with *
0
Inquiry Basket