Recombinant Full Length Human RCC1 protein, His-tagged

Cat.No. : RCC1-01H
Product Overview : Recombinant Human RCC1 protein(NP_001041659.1), fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-421 a.a.
Form : 50 mM Tris-HCl (pH 8.0), 300 mM NaCl
Molecular Mass : The protein has a calculated MW of 46 kDa.
AA Sequence : MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSLEHHHHHH
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.8 mg/ml
Gene Name RCC1 regulator of chromosome condensation 1 [ Homo sapiens (human) ]
Official Symbol RCC1
Synonyms CHC1; RCC1-I; SNHG3-RCC1
Gene ID 1104
mRNA Refseq NM_001048194.4
Protein Refseq NP_001041659.1
MIM 179710
UniProt ID P18754

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCC1 Products

Required fields are marked with *

My Review for All RCC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon