Recombinant Full Length Human Receptor Expression-Enhancing Protein 3(Reep3) Protein, His-Tagged
Cat.No. : | RFL11550HF |
Product Overview : | Recombinant Full Length Human Receptor expression-enhancing protein 3(REEP3) Protein (Q6NUK4) (1-255aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-255) |
Form : | Lyophilized powder |
AA Sequence : | MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY GSLKYKVKKRPQVYF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | REEP3 |
Synonyms | REEP3; C10orf74; Receptor expression-enhancing protein 3 |
UniProt ID | Q6NUK4 |
◆ Recombinant Proteins | ||
REEP3-4907H | Recombinant Human REEP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
REEP3-3841R | Recombinant Rhesus monkey REEP3 Protein, His-tagged | +Inquiry |
Reep3-5451M | Recombinant Mouse Reep3 Protein, Myc/DDK-tagged | +Inquiry |
RFL11550HF | Recombinant Full Length Human Receptor Expression-Enhancing Protein 3(Reep3) Protein, His-Tagged | +Inquiry |
REEP3-4368C | Recombinant Chicken REEP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
REEP3-2427HCL | Recombinant Human REEP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REEP3 Products
Required fields are marked with *
My Review for All REEP3 Products
Required fields are marked with *