Recombinant Full Length Human RFC3 Protein, C-Myc/DDK-tagged
Cat.No. : | RFC3-04HFL |
Product Overview : | Recombinant Full Length Human RFC3 Protein, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG LEGMMF myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Applications : | Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Protein Pathways : | DNA replication, Mismatch repair, Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | RFC3 replication factor C subunit 3 [ Homo sapiens (human) ] |
Official Symbol | RFC3 |
Synonyms | RFC38 |
Gene ID | 5983 |
mRNA Refseq | NM_002915.4 |
Protein Refseq | NP_002906.1 |
MIM | 600405 |
UniProt ID | P40938 |
◆ Recombinant Proteins | ||
RFC3-04HFL | Recombinant Full Length Human RFC3 Protein, C-Myc/DDK-tagged | +Inquiry |
RFC3-1423C | Recombinant Chicken RFC3 | +Inquiry |
Rfc3-5475M | Recombinant Mouse Rfc3 Protein, Myc/DDK-tagged | +Inquiry |
RFC3-11503Z | Recombinant Zebrafish RFC3 | +Inquiry |
RFC3-3857R | Recombinant Rhesus monkey RFC3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFC3-2411HCL | Recombinant Human RFC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RFC3 Products
Required fields are marked with *
My Review for All RFC3 Products
Required fields are marked with *
0
Inquiry Basket