Recombinant Full Length Human RFWD2 protein, Isoform 1, His-tagged
Cat.No. : | RFWD2-170H |
Product Overview : | Recombinant Human RFWD2 protein(NP_001001740.1)(1-731aa) was expressed in E. coli with a N-terminal 6xHis tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-731aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 84.5kDa |
AA Sequence : | MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COP1 |
Official Symbol | COP1 |
Synonyms | Constitutive photomorphogenesis protein 1 homolog; COP; E3 ubiquitin-protein ligase RFWD2; hCOP1; Rfwd2; RFWD2_HUMAN; ring finger and WD repeat domain 2; RING finger and WD repeat domain protein 2; RING finger protein 200 |
Gene ID | 64326 |
mRNA Refseq | NM_001001740.4 |
Protein Refseq | NP_001001740.1 |
MIM | 608067 |
UniProt ID | Q8NHY2 |
◆ Recombinant Proteins | ||
RFWD2-3678R | Recombinant Rhesus Macaque RFWD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFWD2-3861R | Recombinant Rhesus monkey RFWD2 Protein, His-tagged | +Inquiry |
RFWD2-170H | Recombinant Full Length Human RFWD2 protein, Isoform 1, His-tagged | +Inquiry |
RFWD2-185H | Recombinant Full Length Human RFWD2 protein, Isoform 2 | +Inquiry |
RFWD2-14110M | Recombinant Mouse RFWD2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFWD2 Products
Required fields are marked with *
My Review for All RFWD2 Products
Required fields are marked with *