Recombinant Full Length Human RGS4 Protein, C-Flag-tagged
Cat.No. : | RGS4-1464HFL |
Product Overview : | Recombinant Full Length Human RGS4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.1 kDa |
AA Sequence : | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHE CGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRN MLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RGS4 regulator of G protein signaling 4 [ Homo sapiens (human) ] |
Official Symbol | RGS4 |
Synonyms | RGP4; SCZD9 |
Gene ID | 5999 |
mRNA Refseq | NM_005613.6 |
Protein Refseq | NP_005604.1 |
MIM | 602516 |
UniProt ID | P49798 |
◆ Recombinant Proteins | ||
RGS4-14145M | Recombinant Mouse RGS4 Protein | +Inquiry |
RGS4-9906Z | Recombinant Zebrafish RGS4 | +Inquiry |
RGS4-1887H | Recombinant Human RGS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RGS4-301208H | Recombinant Human RGS4 protein, GST-tagged | +Inquiry |
RGS4-5020R | Recombinant Rat RGS4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS4-2372HCL | Recombinant Human RGS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RGS4 Products
Required fields are marked with *
My Review for All RGS4 Products
Required fields are marked with *
0
Inquiry Basket