Recombinant Full Length Human RHOA Protein, C-Flag-tagged
Cat.No. : | RHOA-2117HFL |
Product Overview : | Recombinant Full Length Human RHOA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.6 kDa |
AA Sequence : | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Adherens junction, Axon guidance, Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, T cell receptor signaling pathway, TGF-beta signaling pathway, Tight junction, Vascular smooth muscle contraction, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | RHOA ras homolog family member A [ Homo sapiens (human) ] |
Official Symbol | RHOA |
Synonyms | ARHA; ARH12; RHO12; EDFAOB; RHOH12 |
Gene ID | 387 |
mRNA Refseq | NM_001664.4 |
Protein Refseq | NP_001655.1 |
MIM | 165390 |
UniProt ID | P61586 |
◆ Recombinant Proteins | ||
RHOA-5035R | Recombinant Rat RHOA Protein | +Inquiry |
RHOA-32H | Recombinant Human RHOA protein, His-tagged | +Inquiry |
RHOA-1145H | Recombinant Human Ras Homolog Gene Family, Member A | +Inquiry |
RHOA-2655H | Recombinant Human RHOA Protein, His-tagged | +Inquiry |
Rhoa-641M | Recombinant Mouse Rhoa Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOA-601HCL | Recombinant Human RHOA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHOA Products
Required fields are marked with *
My Review for All RHOA Products
Required fields are marked with *
0
Inquiry Basket