Recombinant Full Length Human RIDA Protein, C-Flag-tagged
| Cat.No. : | RIDA-1678HFL |
| Product Overview : | Recombinant Full Length Human RIDA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables 2-iminobutanoate deaminase activity and mRNA binding activity. Involved in mRNA catabolic process; mRNA destabilization; and organonitrogen compound catabolic process. Located in cytoplasm and nucleus. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | RIDA reactive intermediate imine deaminase A homolog [ Homo sapiens (human) ] |
| Official Symbol | RIDA |
| Synonyms | PSP; P14.5; UK114; HRSP12; hp14.5 |
| Gene ID | 10247 |
| mRNA Refseq | NM_005836.3 |
| Protein Refseq | NP_005827.1 |
| MIM | 602487 |
| UniProt ID | P52758 |
| ◆ Recombinant Proteins | ||
| RIDA-3400H | Recombinant Human RIDA Protein (Met1-Leu137), N-His tagged | +Inquiry |
| RIDA-5045H | Recombinant Human RIDA Protein, GST-tagged | +Inquiry |
| RIDA-3688HF | Recombinant Full Length Human RIDA Protein, GST-tagged | +Inquiry |
| RIDA-1891H | Recombinant Human RIDA Protein, His (Fc)-Avi-tagged | +Inquiry |
| RIDA-1678HFL | Recombinant Full Length Human RIDA Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIDA Products
Required fields are marked with *
My Review for All RIDA Products
Required fields are marked with *



