Recombinant Full Length Human RIDA Protein, C-Flag-tagged
Cat.No. : | RIDA-1678HFL |
Product Overview : | Recombinant Full Length Human RIDA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables 2-iminobutanoate deaminase activity and mRNA binding activity. Involved in mRNA catabolic process; mRNA destabilization; and organonitrogen compound catabolic process. Located in cytoplasm and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RIDA reactive intermediate imine deaminase A homolog [ Homo sapiens (human) ] |
Official Symbol | RIDA |
Synonyms | PSP; P14.5; UK114; HRSP12; hp14.5 |
Gene ID | 10247 |
mRNA Refseq | NM_005836.3 |
Protein Refseq | NP_005827.1 |
MIM | 602487 |
UniProt ID | P52758 |
◆ Recombinant Proteins | ||
Rida-1172M | Recombinant Mouse Rida Protein, MYC/DDK-tagged | +Inquiry |
RIDA-1891H | Recombinant Human RIDA Protein, His (Fc)-Avi-tagged | +Inquiry |
RIDA-3688HF | Recombinant Full Length Human RIDA Protein, GST-tagged | +Inquiry |
RIDA-5045H | Recombinant Human RIDA Protein, GST-tagged | +Inquiry |
RIDA-3400H | Recombinant Human RIDA Protein (Met1-Leu137), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIDA Products
Required fields are marked with *
My Review for All RIDA Products
Required fields are marked with *