Recombinant Full Length Human RIPPLY3 Protein, GST-tagged
Cat.No. : | RIPPLY3-4200HF |
Product Overview : | Human DSCR6 full-length ORF ( NP_061835.1, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 190 amino acids |
Description : | RIPPLY3 (Ripply Transcriptional Repressor 3) is a Protein Coding gene. Diseases associated with RIPPLY3 include Velocardiofacial Syndrome. |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RIPPLY3 ripply transcriptional repressor 3 [ Homo sapiens (human) ] |
Official Symbol | RIPPLY3 |
Synonyms | RIPPLY3; ripply transcriptional repressor 3; Ripply Transcriptional Repressor 3; Down Syndrome Critical Region Protein 6; Down Syndrome Critical Region Gene 6; DSCR6; Ripply3 Homolog (Zebrafish); Protein Ripply3; Ripply3 Homolog; protein ripply3; Down syndrome critical region gene 6; down syndrome critical region protein 6; ripply3 homolog |
Gene ID | 53820 |
mRNA Refseq | NM_001317768 |
Protein Refseq | NP_001304697 |
MIM | 609892 |
UniProt ID | P57055 |
◆ Recombinant Proteins | ||
RIPPLY3-1346H | Recombinant Human RIPPLY3 Protein, MYC/DDK-tagged | +Inquiry |
RIPPLY3-7620M | Recombinant Mouse RIPPLY3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RIPPLY3-14249M | Recombinant Mouse RIPPLY3 Protein | +Inquiry |
RIPPLY3-2886H | Recombinant Human RIPPLY3 Protein, GST-tagged | +Inquiry |
RIPPLY3-4438H | Recombinant Human RIPPLY3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIPPLY3 Products
Required fields are marked with *
My Review for All RIPPLY3 Products
Required fields are marked with *