Recombinant Full Length Human RNF114 Protein, C-Flag-tagged
Cat.No. : | RNF114-176HFL |
Product Overview : | Recombinant Full Length Human RNF114 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD VDEEDMMNQVLQRSIIDQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RNF114 ring finger protein 114 [ Homo sapiens (human) ] |
Official Symbol | RNF114 |
Synonyms | ZNF313; PSORS12 |
Gene ID | 55905 |
mRNA Refseq | NM_018683.4 |
Protein Refseq | NP_061153.1 |
MIM | 612451 |
UniProt ID | Q9Y508 |
◆ Recombinant Proteins | ||
RNF114-504H | Recombinant Human ring finger protein 114, His-tagged | +Inquiry |
RNF114-176HFL | Recombinant Full Length Human RNF114 Protein, C-Flag-tagged | +Inquiry |
RNF114-4727R | Recombinant Rat RNF114 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF114-238Z | Recombinant Zebrafish RNF114 | +Inquiry |
RNF114-5068R | Recombinant Rat RNF114 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF114-2306HCL | Recombinant Human RNF114 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF114 Products
Required fields are marked with *
My Review for All RNF114 Products
Required fields are marked with *
0
Inquiry Basket