Recombinant Full Length Human RNF25 Protein, C-Flag-tagged
Cat.No. : | RNF25-1218HFL |
Product Overview : | Recombinant Full Length Human RNF25 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51 kDa |
AA Sequence : | MAASASAAAGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQV PAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEILTDNNIPHGQCVICLY GFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGQEQEQERQHATTKQKAVGVQCPVCREPLVYDLA SLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLEAERNRYFISLQQPPAPAEPESAVDV SKGSQPPSTLAAELSTSPAVQSTLPPPLPVATQHICEKIPGTRSNQQRLGETQKAMLDPPKPSRGPWRQP ERRHPKGGECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRW ERSKGRTPGSSYPRLPRGQGAYRPGTRRESLGLESKDGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RNF25 ring finger protein 25 [ Homo sapiens (human) ] |
Official Symbol | RNF25 |
Synonyms | AO7 |
Gene ID | 64320 |
mRNA Refseq | NM_022453.3 |
Protein Refseq | NP_071898.2 |
MIM | 616014 |
UniProt ID | Q96BH1 |
◆ Recombinant Proteins | ||
Rnf25-5556M | Recombinant Mouse Rnf25 Protein, Myc/DDK-tagged | +Inquiry |
RNF25-11400Z | Recombinant Zebrafish RNF25 | +Inquiry |
RNF25-1899H | Recombinant Human RNF25 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF25-2894H | Recombinant Human RNF25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNF25-2917C | Recombinant Chicken RNF25 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF25-1526HCL | Recombinant Human RNF25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF25 Products
Required fields are marked with *
My Review for All RNF25 Products
Required fields are marked with *
0
Inquiry Basket