Recombinant Full Length Human RO60 Protein, C-Flag-tagged
Cat.No. : | RO60-1734HFL |
Product Overview : | Recombinant Full Length Human RO60 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA binding activity. Involved in cellular response to interferon-alpha and regulation of gene expression. Located in cytosol and nucleoplasm. Part of ribonucleoprotein complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60 kDa |
AA Sequence : | MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRG CEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMK CGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVH ELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTA LLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEIL KALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKM DIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Systemic lupus erythematosus |
Full Length : | Full L. |
Gene Name | RO60 Ro60, Y RNA binding protein [ Homo sapiens (human) ] |
Official Symbol | RO60 |
Synonyms | SSA2; RORNP; TROVE2 |
Gene ID | 6738 |
mRNA Refseq | NM_001042370.2 |
Protein Refseq | NP_001035829.2 |
MIM | 600063 |
UniProt ID | P10155 |
◆ Recombinant Proteins | ||
RO60-2626H | Recombinant Human RO60 protein(381-530 aa), N-MBP & C-His-tagged | +Inquiry |
Ro60-5565M | Recombinant Mouse Ro60 Protein, Myc/DDK-tagged | +Inquiry |
RO60-1902H | Recombinant Human RO60 Protein, His (Fc)-Avi-tagged | +Inquiry |
RO60-5477H | Recombinant Human RO60 Protein (Met1-IIe538), C-His tagged | +Inquiry |
RO60-2625H | Recombinant Human RO60 protein(381-530 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RO60 Products
Required fields are marked with *
My Review for All RO60 Products
Required fields are marked with *
0
Inquiry Basket