Recombinant Human RO60 protein(381-530 aa), N-MBP & C-His-tagged
| Cat.No. : | RO60-2626H |
| Product Overview : | Recombinant Human RO60 protein(P10155)(381-530 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 381-530 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVI |
| ◆ Recombinant Proteins | ||
| RO60-5477H | Recombinant Human RO60 Protein (Met1-IIe538), C-His tagged | +Inquiry |
| RO60-5961H | Recombinant Human RO60 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RO60-3623H | Recombinant Human RO60 protein, His-tagged | +Inquiry |
| RO60-1734HFL | Recombinant Full Length Human RO60 Protein, C-Flag-tagged | +Inquiry |
| RO60-2625H | Recombinant Human RO60 protein(381-530 aa), C-His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
| RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RO60 Products
Required fields are marked with *
My Review for All RO60 Products
Required fields are marked with *
