Recombinant Full Length Human RPA2 Protein, C-Flag-tagged
Cat.No. : | RPA2-1430HFL |
Product Overview : | Recombinant Full Length Human RPA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a subunit of the heterotrimeric Replication Protein A (RPA) complex, which binds to single-stranded DNA (ssDNA), forming a nucleoprotein complex that plays an important role in DNA metabolism, being involved in DNA replication, repair, recombination, telomere maintenance, and co-ordinating the cellular response to DNA damage through activation of the ataxia telangiectasia and Rad3-related protein (ATR) kinase. The RPA complex protects single-stranded DNA from nucleases, prevents formation of secondary structures that would interfere with repair, and co-ordinates the recruitment and departure of different genome maintenance factors. The heterotrimeric complex has two different modes of ssDNA binding, a low-affinity and high-affinity mode, determined by which oligonucleotide/oligosaccharide-binding (OB) domains of the complex are utilized, and differing in the length of DNA bound. This subunit contains a single OB domain that participates in high-affinity DNA binding and also contains a winged helix domain at its carboxy terminus, which interacts with many genome maintenance protein. Post-translational modifications of the RPA complex also plays a role in co-ordinating different damage response pathways. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVE ISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKS LVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAESGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | RPA2 replication protein A2 [ Homo sapiens (human) ] |
Official Symbol | RPA2 |
Synonyms | REPA2; RPA32; RP-A p32; RP-A p34 |
Gene ID | 6118 |
mRNA Refseq | NM_002946.5 |
Protein Refseq | NP_002937.1 |
MIM | 179836 |
UniProt ID | P15927 |
◆ Recombinant Proteins | ||
RPA2-1430HFL | Recombinant Full Length Human RPA2 Protein, C-Flag-tagged | +Inquiry |
RPA2-2983H | Recombinant Human RPA2, T7-tagged | +Inquiry |
RPA2-31146TH | Recombinant Human RPA2, His-tagged | +Inquiry |
RPA2-30437TH | Recombinant Human RPA2, T7 -tagged | +Inquiry |
RPA2-3776R | Recombinant Rhesus Macaque RPA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPA2-2242HCL | Recombinant Human RPA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPA2 Products
Required fields are marked with *
My Review for All RPA2 Products
Required fields are marked with *
0
Inquiry Basket