Recombinant Full Length Human RPL12 Protein
Cat.No. : | RPL12-446HF |
Product Overview : | Recombinant full length Human RPL12 with N-terminal proprietary tag. Predicted MW 44.22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 165 amino acids |
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L11P family of ribosomal proteins. It is located in the cytoplasm. The protein binds directly to the 26S rRNA. This gene is co-transcribed with the U65 snoRNA, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Form : | Liquid |
Molecular Mass : | 44.220kDa inclusive of tags |
AA Sequence : | MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPK KVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASAL IIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV ECPAS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | RPL12 ribosomal protein L12 [ Homo sapiens ] |
Official Symbol | RPL12 |
Synonyms | RPL12; ribosomal protein L12; 60S ribosomal protein L12; L12 |
Gene ID | 6136 |
mRNA Refseq | NM_000976 |
Protein Refseq | NP_000967 |
MIM | 180475 |
UniProt ID | P30050 |
◆ Recombinant Proteins | ||
RPL12-11566Z | Recombinant Zebrafish RPL12 | +Inquiry |
RPL12-7722M | Recombinant Mouse RPL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL12-7529H | Recombinant Human RPL12, His-tagged | +Inquiry |
RPL12-5056C | Recombinant Chicken RPL12 | +Inquiry |
RPL12-446HF | Recombinant Full Length Human RPL12 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPL12 Products
Required fields are marked with *
My Review for All RPL12 Products
Required fields are marked with *
0
Inquiry Basket