Recombinant Full Length Human RPP25 Protein, C-Flag-tagged
Cat.No. : | RPP25-632HFL |
Product Overview : | Recombinant Full Length Human RPP25 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Located in centriolar satellite and nucleoplasm. Part of multimeric ribonuclease P complex and ribonuclease MRP complex. Biomarker of autistic disorder. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.5 kDa |
AA Sequence : | MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGC GRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLS KDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RPP25 ribonuclease P and MRP subunit p25 [ Homo sapiens (human) ] |
Official Symbol | RPP25 |
Synonyms | FLJ20374 |
Gene ID | 54913 |
mRNA Refseq | NM_017793.3 |
Protein Refseq | NP_060263.2 |
MIM | 619235 |
UniProt ID | Q9BUL9 |
◆ Recombinant Proteins | ||
RPP25-2409H | Recombinant Human RPP25, His-tagged | +Inquiry |
Rpp25-215M | Recombinant Mouse Rpp25 Protein, MYC/DDK-tagged | +Inquiry |
RPP25-5144R | Recombinant Rat RPP25 Protein | +Inquiry |
RPP25-7762M | Recombinant Mouse RPP25 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPP25-632HFL | Recombinant Full Length Human RPP25 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPP25 Products
Required fields are marked with *
My Review for All RPP25 Products
Required fields are marked with *