Recombinant Full Length Human RRAD Protein, C-Flag-tagged
Cat.No. : | RRAD-1676HFL |
Product Overview : | Recombinant Full Length Human RRAD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable GTP binding activity and calcium channel regulator activity. Predicted to be involved in small GTPase mediated signal transduction. Predicted to be located in cytosol. Predicted to be active in plasma membrane. Implicated in type 2 diabetes mellitus. Biomarker of congestive heart failure. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.1 kDa |
AA Sequence : | MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR FLGRIVARNSRKMAFRAKSKSCHDLSVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RRAD RRAD, Ras related glycolysis inhibitor and calcium channel regulator [ Homo sapiens (human) ] |
Official Symbol | RRAD |
Synonyms | RAD; RAD1; REM3 |
Gene ID | 6236 |
mRNA Refseq | NM_004165.3 |
Protein Refseq | NP_004156.1 |
MIM | 179503 |
UniProt ID | P55042 |
◆ Recombinant Proteins | ||
RRAD-30772TH | Recombinant Human RRAD | +Inquiry |
RRAD-1676HFL | Recombinant Full Length Human RRAD Protein, C-Flag-tagged | +Inquiry |
RRAD-10186Z | Recombinant Zebrafish RRAD | +Inquiry |
RRAD-6686H | Recombinant Human RRAD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RRAD-4985C | Recombinant Chicken RRAD | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRAD Products
Required fields are marked with *
My Review for All RRAD Products
Required fields are marked with *
0
Inquiry Basket