Recombinant Full Length Human RRAGD Protein, C-Flag-tagged
Cat.No. : | RRAGD-1834HFL |
Product Overview : | Recombinant Full Length Human RRAGD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.4 kDa |
AA Sequence : | MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGL RRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGA LIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLE KIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDM QTYELCCDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERK GLIDYNFHCFRKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RRAGD Ras related GTP binding D [ Homo sapiens (human) ] |
Official Symbol | RRAGD |
Synonyms | RAGD; HOMG7; bA11D8.2.1 |
Gene ID | 58528 |
mRNA Refseq | NM_021244.5 |
Protein Refseq | NP_067067.1 |
MIM | 608268 |
UniProt ID | Q9NQL2 |
◆ Recombinant Proteins | ||
RRAGD-5768Z | Recombinant Zebrafish RRAGD | +Inquiry |
RRAGD-1919H | Recombinant Human RRAGD Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAGD-1834HFL | Recombinant Full Length Human RRAGD Protein, C-Flag-tagged | +Inquiry |
Rragd-5622M | Recombinant Mouse Rragd Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRAGD-2145HCL | Recombinant Human RRAGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRAGD Products
Required fields are marked with *
My Review for All RRAGD Products
Required fields are marked with *
0
Inquiry Basket