Recombinant Full Length Human RTCB Protein, C-Flag-tagged
Cat.No. : | RTCB-1083HFL |
Product Overview : | Recombinant Full Length Human RTCB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA ligase (ATP) activity and vinculin binding activity. Involved in tRNA splicing, via endonucleolytic cleavage and ligation. Located in cytosol and nucleoplasm. Part of tRNA-splicing ligase complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55 kDa |
AA Sequence : | MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIG NVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVK EQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSAR AKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKA MKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYD VSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMT ETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGI SKKAIKLRPIAVIKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RTCB RNA 2',3'-cyclic phosphate and 5'-OH ligase [ Homo sapiens (human) ] |
Official Symbol | RTCB |
Synonyms | FAAP; HSPC117; C22orf28; DJ149A16.6 |
Gene ID | 51493 |
mRNA Refseq | NM_014306.5 |
Protein Refseq | NP_055121.1 |
MIM | 613901 |
UniProt ID | Q9Y3I0 |
◆ Recombinant Proteins | ||
RTCB-1083HFL | Recombinant Full Length Human RTCB Protein, C-Flag-tagged | +Inquiry |
RTCB-635C | Recombinant Cynomolgus Monkey RTCB Protein, His (Fc)-Avi-tagged | +Inquiry |
RTCB-2111E | Recombinant Escherichia coli RTCB Protein (1-408 aa), His-SUMO-tagged | +Inquiry |
Rtcb-5639M | Recombinant Mouse Rtcb Protein, Myc/DDK-tagged | +Inquiry |
RTCB-396H | Recombinant Human RTCB Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RTCB Products
Required fields are marked with *
My Review for All RTCB Products
Required fields are marked with *