Recombinant Full Length Human RTCB Protein, C-Flag-tagged
| Cat.No. : | RTCB-1083HFL |
| Product Overview : | Recombinant Full Length Human RTCB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables RNA ligase (ATP) activity and vinculin binding activity. Involved in tRNA splicing, via endonucleolytic cleavage and ligation. Located in cytosol and nucleoplasm. Part of tRNA-splicing ligase complex. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 55 kDa |
| AA Sequence : | MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIG NVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVK EQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSAR AKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKA MKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYD VSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMT ETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGI SKKAIKLRPIAVIKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | RTCB RNA 2',3'-cyclic phosphate and 5'-OH ligase [ Homo sapiens (human) ] |
| Official Symbol | RTCB |
| Synonyms | FAAP; HSPC117; C22orf28; DJ149A16.6 |
| Gene ID | 51493 |
| mRNA Refseq | NM_014306.5 |
| Protein Refseq | NP_055121.1 |
| MIM | 613901 |
| UniProt ID | Q9Y3I0 |
| ◆ Recombinant Proteins | ||
| RTCB-1083HFL | Recombinant Full Length Human RTCB Protein, C-Flag-tagged | +Inquiry |
| RTCB-396H | Recombinant Human RTCB Protein, His-tagged | +Inquiry |
| RTCB-1954H | Recombinant Human RTCB Protein, MYC/DDK-tagged | +Inquiry |
| RTCB-6278H | Recombinant Human RTCB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RTCB-892C | Recombinant Cynomolgus RTCB Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RTCB Products
Required fields are marked with *
My Review for All RTCB Products
Required fields are marked with *
