Recombinant Full Length Human S100 calcium binding protein A4 Protein, His tagged

Cat.No. : S100A4-409H
Product Overview : Recombinant Full Length Human S100A4 Protein with N-His tag was expressed in E. coli.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-101 aa
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Tag : N-His
Molecular Mass : 14 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 5% Trehalose, 10% Glycerol
Concentration : 1 mg/mL by BCA
Gene Name S100A4 S100 calcium binding protein A4 [ Homo sapiens (human) ]
Official Symbol S100A4
Synonyms S100A4; S100 calcium binding protein A4; CAPL, MTS1, S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) , S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); protein S100-A4; 18A2; 42A; fibroblast specific protein 1; FSP1; P9KA; PEL98; protein Mts1; fibroblast-specific protein-1; placental calcium-binding protein; malignant transformation suppression 1; leukemia multidrug resistance associated protein; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); CAPL; MTS1
Gene ID 6275
mRNA Refseq NM_002961
Protein Refseq NP_002952
MIM 114210
UniProt ID P26447

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A4 Products

Required fields are marked with *

My Review for All S100A4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon