Recombinant Full Length Human S100 calcium binding protein A4 Protein, His tagged
| Cat.No. : | S100A4-409H |
| Product Overview : | Recombinant Full Length Human S100A4 Protein with N-His tag was expressed in E. coli. |
| Availability | August 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-101 aa |
| Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Tag : | N-His |
| Molecular Mass : | 14 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 5% Trehalose, 10% Glycerol |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | S100A4 S100 calcium binding protein A4 [ Homo sapiens (human) ] |
| Official Symbol | S100A4 |
| Synonyms | S100A4; S100 calcium binding protein A4; CAPL, MTS1, S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) , S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); protein S100-A4; 18A2; 42A; fibroblast specific protein 1; FSP1; P9KA; PEL98; protein Mts1; fibroblast-specific protein-1; placental calcium-binding protein; malignant transformation suppression 1; leukemia multidrug resistance associated protein; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); CAPL; MTS1 |
| Gene ID | 6275 |
| mRNA Refseq | NM_002961 |
| Protein Refseq | NP_002952 |
| MIM | 114210 |
| UniProt ID | P26447 |
| ◆ Recombinant Proteins | ||
| S100a4-3542M | Recombinant Mouse S100a4, His-tagged | +Inquiry |
| S100A4-2489H | Recombinant Full Length Human S100A4, GST-tagged | +Inquiry |
| S100A4-4590H | Recombinant Human S100A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| S100A4-2120C | Recombinant Cattle S100A4 protein, His-tagged | +Inquiry |
| S100A4-1455H | Recombinant Human S100A4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A4-2859HCL | Recombinant Human S100A4 cell lysate | +Inquiry |
| S100A4-001MCL | Recombinant Mouse S100A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A4 Products
Required fields are marked with *
My Review for All S100A4 Products
Required fields are marked with *



