Recombinant Full Length Human S100A11 Protein, C-Flag-tagged
Cat.No. : | S100A11-1178HFL |
Product Overview : | Recombinant Full Length Human S100A11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.6 kDa |
AA Sequence : | MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | S100A11 S100 calcium binding protein A11 [ Homo sapiens (human) ] |
Official Symbol | S100A11 |
Synonyms | MLN70; S100C; HEL-S-43 |
Gene ID | 6282 |
mRNA Refseq | NM_005620.2 |
Protein Refseq | NP_005611.1 |
MIM | 603114 |
UniProt ID | P31949 |
◆ Recombinant Proteins | ||
S100A11-3444H | Recombinant Human S100A11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A11-1178HFL | Recombinant Full Length Human S100A11 Protein, C-Flag-tagged | +Inquiry |
S100A11-5211R | Recombinant Rat S100A11 Protein | +Inquiry |
S100A11-3102H | Recombinant Human S100A11, None tagged | +Inquiry |
S100A11-7865M | Recombinant Mouse S100A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A11-2095HCL | Recombinant Human S100A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A11 Products
Required fields are marked with *
My Review for All S100A11 Products
Required fields are marked with *
0
Inquiry Basket