Recombinant Full Length Human S100A14 Protein, C-Flag-tagged
Cat.No. : | S100A14-2089HFL |
Product Overview : | Recombinant Full Length Human S100A14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.5 kDa |
AA Sequence : | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | S100A14 S100 calcium binding protein A14 [ Homo sapiens (human) ] |
Official Symbol | S100A14 |
Synonyms | BCMP84; S100A15 |
Gene ID | 57402 |
mRNA Refseq | NM_020672.3 |
Protein Refseq | NP_065723.1 |
MIM | 607986 |
UniProt ID | Q9HCY8 |
◆ Recombinant Proteins | ||
S100A14-5821H | Recombinant Human S100A14 protein, His-sumostar-tagged | +Inquiry |
S100A14-1564H | Recombinant Human S100 Calcium Binding Protein A14, T7-tagged | +Inquiry |
S100A14-3018H | Recombinant Human S100A14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A14-2452H | Recombinant Human S100A14 Protein (1-104 aa), His-tagged | +Inquiry |
S100A14-2089HFL | Recombinant Full Length Human S100A14 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A14-2092HCL | Recombinant Human S100A14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A14 Products
Required fields are marked with *
My Review for All S100A14 Products
Required fields are marked with *
0
Inquiry Basket