Recombinant Full Length Human S100A8 Protein, C-Flag-tagged
Cat.No. : | S100A8-1684HFL |
Product Overview : | Recombinant Full Length Human S100A8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 10.7 kDa |
AA Sequence : | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | S100A8 S100 calcium binding protein A8 [ Homo sapiens (human) ] |
Official Symbol | S100A8 |
Synonyms | P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG; S100-A8 |
Gene ID | 6279 |
mRNA Refseq | NM_002964.5 |
Protein Refseq | NP_002955.2 |
MIM | 123885 |
UniProt ID | P05109 |
◆ Recombinant Proteins | ||
S100A8-0316D | Recombinant Dog S100A8 Protein, His-tagged | +Inquiry |
S100A8-3732H | Recombinant Human S100A8, His-tagged | +Inquiry |
S100a8-01M | Active Recombinant Mouse S100a8 Protein | +Inquiry |
S100A8-3387M | Recombinant Mouse S100A8 protein, His-tagged | +Inquiry |
S100a8-405M | Recombinant Mouse S100A8 protein(Pro2-Glu89), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A8-685HCL | Recombinant Human S100A8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A8 Products
Required fields are marked with *
My Review for All S100A8 Products
Required fields are marked with *
0
Inquiry Basket