Recombinant Full Length Human SAP30BP Protein, GST-tagged
Cat.No. : | SAP30BP-3536HF |
Product Overview : | Human HCNGP full-length ORF ( AAH07592, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 308 amino acids |
Description : | SAP30BP (SAP30 Binding Protein) is a Protein Coding gene. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Gene Expression. |
Molecular Mass : | 59.62 kDa |
AA Sequence : | MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SAP30BP SAP30 binding protein [ Homo sapiens (human) ] |
Official Symbol | SAP30BP |
Synonyms | SAP30BP; SAP30 binding protein; HTRG; HTRP; HCNGP; SAP30-binding protein; HSV-1 binding; transcriptional regulator protein HCNGP |
Gene ID | 29115 |
mRNA Refseq | NM_001301839 |
Protein Refseq | NP_001288768 |
MIM | 610218 |
UniProt ID | Q9UHR5 |
◆ Recombinant Proteins | ||
SAP30BP-14670M | Recombinant Mouse SAP30BP Protein | +Inquiry |
SAP30BP-4890H | Recombinant Full Length Human SAP30BP protein, GST-tagged | +Inquiry |
SAP30BP-7900M | Recombinant Mouse SAP30BP Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP30BP-4073R | Recombinant Rhesus monkey SAP30BP Protein, His-tagged | +Inquiry |
SAP30BP-3890R | Recombinant Rhesus Macaque SAP30BP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAP30BP-2068HCL | Recombinant Human SAP30BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAP30BP Products
Required fields are marked with *
My Review for All SAP30BP Products
Required fields are marked with *
0
Inquiry Basket