Recombinant Full Length Human SAP30BP Protein, GST-tagged

Cat.No. : SAP30BP-3536HF
Product Overview : Human HCNGP full-length ORF ( AAH07592, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 308 amino acids
Description : SAP30BP (SAP30 Binding Protein) is a Protein Coding gene. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Gene Expression.
Molecular Mass : 59.62 kDa
AA Sequence : MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SAP30BP SAP30 binding protein [ Homo sapiens (human) ]
Official Symbol SAP30BP
Synonyms SAP30BP; SAP30 binding protein; HTRG; HTRP; HCNGP; SAP30-binding protein; HSV-1 binding; transcriptional regulator protein HCNGP
Gene ID 29115
mRNA Refseq NM_001301839
Protein Refseq NP_001288768
MIM 610218
UniProt ID Q9UHR5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAP30BP Products

Required fields are marked with *

My Review for All SAP30BP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon