Recombinant Full Length Human SAT2 Protein, C-Flag-tagged

Cat.No. : SAT2-2144HFL
Product Overview : Recombinant Full Length Human SAT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables diamine N-acetyltransferase activity and identical protein binding activity. Involved in polyamine metabolic process. Located in extracellular exosome.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 19 kDa
AA Sequence : MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY KALGAQDLTEAEGWHFFCFQGEATRKLAGK myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Arginine and proline metabolism, Metabolic pathways
Full Length : Full L.
Gene Name SAT2 spermidine/spermine N1-acetyltransferase family member 2 [ Homo sapiens (human) ]
Official Symbol SAT2
Synonyms SSAT2; SSAT-2
Gene ID 112483
mRNA Refseq NM_133491.5
Protein Refseq NP_597998.1
MIM 611463
UniProt ID Q96F10

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAT2 Products

Required fields are marked with *

My Review for All SAT2 Products

Required fields are marked with *

0
cart-icon