Recombinant Full Length Human SAT2 Protein, C-Flag-tagged
Cat.No. : | SAT2-2144HFL |
Product Overview : | Recombinant Full Length Human SAT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables diamine N-acetyltransferase activity and identical protein binding activity. Involved in polyamine metabolic process. Located in extracellular exosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19 kDa |
AA Sequence : | MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY KALGAQDLTEAEGWHFFCFQGEATRKLAGK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Arginine and proline metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | SAT2 spermidine/spermine N1-acetyltransferase family member 2 [ Homo sapiens (human) ] |
Official Symbol | SAT2 |
Synonyms | SSAT2; SSAT-2 |
Gene ID | 112483 |
mRNA Refseq | NM_133491.5 |
Protein Refseq | NP_597998.1 |
MIM | 611463 |
UniProt ID | Q96F10 |
◆ Recombinant Proteins | ||
SAT2-2144HFL | Recombinant Full Length Human SAT2 Protein, C-Flag-tagged | +Inquiry |
SAT2-3897R | Recombinant Rhesus Macaque SAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sat2-5695M | Recombinant Mouse Sat2 Protein, Myc/DDK-tagged | +Inquiry |
SAT2-1956H | Recombinant Human SAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAT2-4080R | Recombinant Rhesus monkey SAT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAT2-2055HCL | Recombinant Human SAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAT2 Products
Required fields are marked with *
My Review for All SAT2 Products
Required fields are marked with *