Recombinant Full Length Human SAT2 Protein, C-Flag-tagged

• Cat.No.: SAT2-2144HFL
• Product Overview: Recombinant Full Length Human SAT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables diamine N-acetyltransferase activity and identical protein binding activity. Involved in polyamine metabolic process. Located in extracellular exosome.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 19 kDa
• AA Sequence: MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY KALGAQDLTEAEGWHFFCFQGEATRKLAGK myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways
• Full Length: Full L.

Gene Information

• Gene Name: SAT2 spermidine/spermine N1-acetyltransferase family member 2 [ Homo sapiens (human) ]
• Official Symbol: SAT2
• Synonyms: SSAT2; SSAT-2
• Gene ID: 112483
• mRNA Refseq: NM_133491.5
• Protein Refseq: NP_597998.1
• MIM: 611463
• UniProt ID: Q96F10