Recombinant Full Length Human SERPINH1 Protein, C-Flag-tagged
Cat.No. : | SERPINH1-495HFL |
Product Overview : | Recombinant Full Length Human SERPINH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.5 kDa |
AA Sequence : | MRSLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVS PVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSV SFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDGKLPEVTKDVERTDGALLVNAMFFKPHW DEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLIIFMPHHVEPLER LEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLAS VFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | SERPINH1 serpin family H member 1 [ Homo sapiens (human) ] |
Official Symbol | SERPINH1 |
Synonyms | CBP1; CBP2; OI10; gp46; AsTP3; HSP47; PIG14; PPROM; RA-A47; SERPINH2 |
Gene ID | 871 |
mRNA Refseq | NM_001235.5 |
Protein Refseq | NP_001226.2 |
MIM | 600943 |
UniProt ID | P50454 |
◆ Recombinant Proteins | ||
SERPINH1-2687H | Recombinant Human SERPINH1 Protein, His-tagged | +Inquiry |
Serpinh1-790M | Recombinant Mouse Serpinh1 Protein, MYC/DDK-tagged | +Inquiry |
SERPINH1-6656H | Recombinant Human SERPINH1 Protein (Ala19-Leu418), C-His tagged | +Inquiry |
SERPINH1-576H | Recombinant Full Length Human SERPINH1 Protein, His-tagged | +Inquiry |
SERPINH1-329H | Recombinant Human SERPINH1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINH1-1936HCL | Recombinant Human SERPINH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINH1 Products
Required fields are marked with *
My Review for All SERPINH1 Products
Required fields are marked with *
0
Inquiry Basket