Recombinant Full Length Human SERTM1 Protein, GST-tagged

Cat.No. : SERTM1-1781HF
Product Overview : Human C13orf36 full-length ORF (AAH36540.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 107 amino acids
Description : Located in intracellular membrane-bounded organelle.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.17 kDa
AA Sequence : MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNIISSSSSYPGYPSDAGSSFTNLEVCSISSQRSTFSNLSS
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SERTM1 serine-rich and transmembrane domain containing 1 [ Homo sapiens ]
Official Symbol SERTM1
Synonyms SERTM1; serine-rich and transmembrane domain containing 1; C13orf36, chromosome 13 open reading frame 36; serine-rich and transmembrane domain-containing protein 1; serine-rich and transmembrane domain-containing 1; C13orf36; RP11-16L6.1; MGC33996
Gene ID 400120
mRNA Refseq NM_203451
Protein Refseq NP_982276
UniProt ID A2A2V5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERTM1 Products

Required fields are marked with *

My Review for All SERTM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon