Recombinant Full Length Human SERTM1 Protein, GST-tagged
| Cat.No. : | SERTM1-1781HF |
| Product Overview : | Human C13orf36 full-length ORF (AAH36540.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 107 amino acids |
| Description : | Located in intracellular membrane-bounded organelle. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 38.17 kDa |
| AA Sequence : | MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNIISSSSSYPGYPSDAGSSFTNLEVCSISSQRSTFSNLSS |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SERTM1 serine-rich and transmembrane domain containing 1 [ Homo sapiens ] |
| Official Symbol | SERTM1 |
| Synonyms | SERTM1; serine-rich and transmembrane domain containing 1; C13orf36, chromosome 13 open reading frame 36; serine-rich and transmembrane domain-containing protein 1; serine-rich and transmembrane domain-containing 1; C13orf36; RP11-16L6.1; MGC33996 |
| Gene ID | 400120 |
| mRNA Refseq | NM_203451 |
| Protein Refseq | NP_982276 |
| UniProt ID | A2A2V5 |
| ◆ Recombinant Proteins | ||
| SERTM1-1323H | Recombinant Human SERTM1 | +Inquiry |
| RFL28156MF | Recombinant Full Length Mouse Serine-Rich And Transmembrane Domain-Containing Protein 1(Sertm1) Protein, His-Tagged | +Inquiry |
| SERTM1-14971M | Recombinant Mouse SERTM1 Protein | +Inquiry |
| SERTM1-8062M | Recombinant Mouse SERTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SERTM1-1781HF | Recombinant Full Length Human SERTM1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERTM1-8297HCL | Recombinant Human C13orf36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERTM1 Products
Required fields are marked with *
My Review for All SERTM1 Products
Required fields are marked with *



