Recombinant Full Length Human SET Protein
Cat.No. : | SET-466HF |
Product Overview : | Recombinant full length Human SET isoform 2 with N terminal proprietary tag, 55.88 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 277 amino acids |
Description : | The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 55.880kDa inclusive of tags |
AA Sequence : | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQN EIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPN FWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKS GYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKW KSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDE EEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SET SET nuclear oncogene [ Homo sapiens ] |
Official Symbol | SET |
Synonyms | SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor |
Gene ID | 6418 |
mRNA Refseq | NM_001122821 |
Protein Refseq | NP_001116293 |
MIM | 600960 |
UniProt ID | Q01105 |
◆ Recombinant Proteins | ||
Set-13MFL | Recombinant Full Length Mouse SET nuclear oncogene Protein, Flag tagged | +Inquiry |
SET-2047H | Recombinant Human SET Nuclear Oncogene | +Inquiry |
SET-2048H | Recombinant Human SET Nuclear Oncogene, GST-tagged | +Inquiry |
SET-30076TH | Recombinant Human SET | +Inquiry |
SET-8065M | Recombinant Mouse SET Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SET-1928HCL | Recombinant Human SET 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SET Products
Required fields are marked with *
My Review for All SET Products
Required fields are marked with *