Recombinant Full Length Human SET Protein

Cat.No. : SET-466HF
Product Overview : Recombinant full length Human SET isoform 2 with N terminal proprietary tag, 55.88 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 277 amino acids
Description : The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : 55.880kDa inclusive of tags
AA Sequence : MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQN EIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPN FWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKS GYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKW KSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDE EEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name SET SET nuclear oncogene [ Homo sapiens ]
Official Symbol SET
Synonyms SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor
Gene ID 6418
mRNA Refseq NM_001122821
Protein Refseq NP_001116293
MIM 600960
UniProt ID Q01105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SET Products

Required fields are marked with *

My Review for All SET Products

Required fields are marked with *

0
cart-icon