Recombinant Full Length Human SET Protein
Cat.No. : | SET-466HF |
Product Overview : | Recombinant full length Human SET isoform 2 with N terminal proprietary tag, 55.88 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 55.880kDa inclusive of tags |
Protein Length : | 277 amino acids |
AA Sequence : | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQN EIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPN FWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKS GYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKW KSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDE EEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SET SET nuclear oncogene [ Homo sapiens ] |
Official Symbol : | SET |
Synonyms : | SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor |
Gene ID : | 6418 |
mRNA Refseq : | NM_001122821 |
Protein Refseq : | NP_001116293 |
MIM : | 600960 |
UniProt ID : | Q01105 |
Products Types
◆ Recombinant Protein | ||
SET-5007R | Recombinant Rat SET Protein, His (Fc)-Avi-tagged | +Inquiry |
SET-8065M | Recombinant Mouse SET Protein, His (Fc)-Avi-tagged | +Inquiry |
SET-2446H | Recombinant Human SET Nuclear Oncogene, GST-tagged | +Inquiry |
Set-5797M | Recombinant Mouse Set Protein, Myc/DDK-tagged | +Inquiry |
SET-2047H | Recombinant Human SET Nuclear Oncogene | +Inquiry |
◆ Lysates | ||
SET-1928HCL | Recombinant Human SET 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket