Recombinant Full Length Human SET nuclear oncogene Protein, Flag tagged

Cat.No. : SET-02HFL
Product Overview : Recombinant protein of human SET nuclear oncogene (SET), transcript variant 2 with C-Flag tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Protein Length : 1-290 aa
Description : The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene.
Tag : C-Flag
Molecular Mass : 31.9 kDa
AA Sequence : MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Storage Buffer : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Concentration : >0.05 μg/μL as determined by microplate BCA method
Gene Name SET SET nuclear oncogene [ Homo sapiens ]
Official Symbol SET
Synonyms SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor; HLA-DR-associated protein II; phosphatase 2A inhibitor I2PP2A; inhibitor-2 of protein phosphatase-2A; inhibitor of granzyme A-activated DNase; SET translocation (myeloid leukemia-associated); Template-Activating Factor-I, chromatin remodelling factor; IGAAD; TAF-I; I2PP2A; TAF-IBETA
Gene ID 6418
mRNA Refseq NM_003011
Protein Refseq NP_003002
MIM 600960
UniProt ID Q01105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SET Products

Required fields are marked with *

My Review for All SET Products

Required fields are marked with *

0
cart-icon
0
compare icon